StatusResultsProject nameInput dataWay of selecting bridges Last status changedJob submittedKeyUser IP
finished No loops found! Example chain without bridges input.pdb.bz2 automatic 2015-12-31 12:00:00 2015-12-31 12:00:00 no-bridge exampleIP
No loops found!

Chain Sequence
MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRVKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
This job will be automatically deleted within 14 days after submission

LassoProt | Interdisciplinary Laboratory of Biological Systems Modelling